allmonthweektoday populardaterelevant 1 Christmas Canon Remix Contest (Year 2)(CallyKay) CallyKay uncategorized canonchristmasketramdancemusicboom!daymofunyay 0:02:34 44 416 2013-12-05 Favorite Share Remix 2 Last Minut35 - Down the street Last Minut35 uncategorized edmdemooffdemonstrationdustdubstepminut35shortlastlm35nodrumscomplextronodrums 0:03:37 154 2231 2014-06-01 Favorite Share Remix 3 Undeniable CallyKay uncategorized chickenlambdabeautifulencouraginngbeen sickdaymoorchestramelodicsymphonyupliftingoriginal 0:04:13 60 550 2013-02-18 Favorite Share Remix 4 ANIMILEY Last Minut35 uncategorized rocksteprockedmmartinsamplesanimalsmileyheavygarrixcyrusvegassony 0:00:16 41 825 2014-05-15 Favorite Share Remix 5 Fun with overused samples #1 Last Minut35 uncategorized overusedglockenspielsamplespianochopdancehouseelectrogroovy 0:01:38 26 255 2013-10-22 Favorite Share Remix 6 Last Call Sir Zero ゼロさん Ambient scarytrapcollabdarkcinematicorchestralcreepybassmelodic 0:02:33 21 226 2019-01-18 Favorite Share 7 LM35 - Plex (demo) Last Minut35 uncategorized 0:00:38 23 178 2014-03-03 Favorite Share Remix 8 MAELSTROMSTEP evolution Last Minut35 uncategorized maelstormsteplolmaelstromstepdubstepmaelstromluxiorsamplesbpm140140bpmchopdatdrumzthomaelstormponies 0:01:49 20 204 2014-02-15 Favorite Share Remix 9 Fun with overused samples #2 Last Minut35 uncategorized overuseoverusedthanksaudiotoolminut35whatdropitlewieffectsamplesspintrapbooooooooooomusecommatoseparatetagslastwutlm35dublastminut35sfxwithfunbassboomsnapthatbasstho 0:00:24 15 147 2014-04-03 Favorite Share Remix 10 House call ( Klub Affekt Mix) Uprising uncategorized houseuprisingi think 0:05:44 121 2238 2012-04-14 Favorite Share 11 Last Minut35 - Speechless - Verse Loop / Preview Last Minut35 uncategorized speechlessminut35lastlm35sampleloops 0:00:30 5 131 2013-07-24 Favorite Share Remix 12 Last Memory XculE uncategorized trancepianosad 0:03:14 27 591 2015-06-02 Favorite Share 13 the last scream from a dying immortal (pre-intro) virux 1 Bass Music rockdubstepatd22soundtracktearoutviruxvoidwalkers nightmare 0:06:20 35 509 2022-12-31 Favorite Share Remix 14 Last Call DJ PUrG3© Trap independentraptrapelevated808last callbangerchillinstrumentalhip hopmidwest muzikphone 0:03:41 2 12 2019-07-29 Favorite Share 15 Bryson tiller Type beat Last Call DRECO DRE uncategorized 0:04:04 5 95 2017-03-07 Favorite Share Remix 16 CallyKay Remix Contest (Lego Remix) TheLegoBoy uncategorized thelegoboycallykayremix contestcallykay remix contest 0:03:58 1 502 2012-11-27 Favorite Share Remix 17 different world al prog uncategorized jakethanks170bpmdnbpoordrum & bassmelodiccallyrnzr 0:03:55 33 159 2013-03-15 Favorite Share 18 Zelvo's mating call 1 Not last minut35 uncategorized 0:00:01 1 7 2016-10-19 Favorite Share Remix 19 Zelvo's mating call 2 Not last minut35 uncategorized 0:00:04 1 6 2016-10-19 Favorite Share Remix 20 Call Me Thunder [Experimental Funk | Draft #905] - Dreamhack Qua-Z 2 Downtempo breaksexperimentalfunkyatd22qua-zdreamhack 0:03:24 12 253 2022-12-19 Favorite Share Remix 21 Titanic last call (compo dark ambiance ) Asclepeion uncategorized electronicdarkambiance 0:01:20 2 162 2011-04-27 Favorite Share Remix 22 TJStyles- last call TJ Styles uncategorized 0:03:54 1 22 2015-03-11 Favorite Share Remix 23 the last call nixoo Bass Music basstratrap 0:07:14 1 19 2024-01-31 Favorite Share Remix 24 Cyborg Mating Call Catakylm uncategorized newofmusicmksmokematingballscallmktcyborgsteeldukenukemg.o.o.dcatakylmkcmomk3mkamkdforumcyraxsketor 0:02:39 2 58 2011-10-29 Favorite Share Remix 25 Synergy (Nav X Dark) Vectorshock (DARKLITE) uncategorized 0:04:09 167 2793 2015-04-25 Favorite Share 26 apogee opaqity Ambient 2 0:03:10 320 7790 2018-01-01 Favorite Share Remix 27 i build my selfsky 1trillionMPH 1 EDM unstoppable object 0:05:11 79 922 2021-03-26 Favorite Share Remix 28 proud to call my own XxDJ17xX uncategorized 0:02:56 2 2632 2012-10-08 Favorite Share Remix 29 would have been (ft po9t) po9t 1 Hip Hop would have beennicohiphoptraphyperpopudmnoumenalunconditionedpo9t 0:02:51 142 4209 2022-04-06 Favorite Share 30 Sequence IV kiari Techno house 0:06:15 49 726 2014-06-03 Favorite Share Remix 31 The Befolife Part -1 Part 2: It's Still Actually The Aftalife Part 4 But I Explained It In The Last Title You Can Call It Whatever Works For You Anyways This Time The Devil Shows Up JohnnyBonny69 uncategorized swagrockcheesedeathgoddubstepbrassdadpoprapwarbattleyolodogdevilmonkeydarkepicdeepmaturemoneyepicnicesadmetalboner 0:06:58 3 168 2015-08-03 Favorite Share Remix 32 Poet Vocal REMIX CHALLENGE (pt 2) po9t 1 Newbie challengeslowhiphoppopraprappertrappianohomepoetbeatdepressedsampleambientcompetitionvocaltypesadsingingremix 0:02:33 216 5638 2021-03-18 Favorite Share Remix