allmonthweektoday populardaterelevant 1 For Cry Sock Puppet Mayhem uncategorized crycryaoticchaoticmonki 0:02:22 60 3702 2012-11-14 Favorite Share Remix 2 MayFlower Crybabyschild uncategorized 0:00:36 4 35 2016-11-03 Favorite Share 3 Bloody Trapland w/ Pewdiepie and ChaoticMonki Sock Puppet Mayhem uncategorized bloodypewdiepiechaoticmonkiyaytraplandcry 0:02:18 16 1417 2012-11-30 Favorite Share Remix 4 Neocterix - EarthBound (Cryonaty's House Remix) Cryonaty uncategorized clickbait titles 0:04:48 4 114 2016-04-25 Favorite Share Remix 5 her (ft. May Cry.) yōsei (escapiistt) Other plaguemay cryher 0:01:22 14 123 2021-10-12 Favorite Share Remix 6 Crystalize Serra Netti Experimental traprapinstrumental 0:01:42 4 54 2020-02-29 Favorite Share Remix 7 Ghosty cry Amp7070 Other 0:02:22 35 339 2021-02-02 Favorite Share 8 HeavenHell ( Devil May Cry ) [offbeatninja] uncategorized groovehip-hopanimetechnomaybloodoffbeatninjacrydevildante 0:03:08 9 169 2012-06-11 Favorite Share Remix 9 DEVIL MAY CRY! TAZONTHABEAT Trap trapnudypierrecartidsavage 0:02:42 9 42 2020-07-05 Favorite Share 10 Far Cry PINK SALMON (IN_VERT) uncategorized 0:03:45 17 237 2013-05-27 Favorite Share Remix 11 SK Crying Angle AintonMusic uncategorized beat155860scalacollege 0:00:22 8 86 2015-01-13 Favorite Share Remix 12 Crystalline Stars SwimmUnicorn Experimental ambient chipmaybeidk 0:02:46 2 7 2022-09-20 Favorite Share Remix 13 im gonna fix this maybe Zen Bass Music deathstep 0:01:11 6 34 2021-01-08 Favorite Share Remix 14 DEVIL MAY CRY 2 TAZONTHABEAT Trap trapnudy 0:01:36 3 19 2021-12-09 Favorite Share Remix 15 Underground Explorations Dei Servus uncategorized spaceycrystalsmagnificentdei servus3/4bassdrumsunderground 0:05:46 20 1156 2012-10-13 Favorite Share Remix 16 Devil May Cry fullburst uncategorized 0:03:15 1 63 2014-08-09 Favorite Share Remix 17 Crying Flowers Ranger2108 uncategorized edm 0:00:50 1 7 2016-02-15 Favorite Share Remix 18 r a i n Progressive Failure Lo-Fi thunderhip-hoprainabstract culturebump 0:02:33 6 58 2015-04-06 Favorite Share Remix 19 sad but lovey piano pokemon550 uncategorized sad 0:01:36 5 411 2012-11-30 Favorite Share 20 ZombieBot (Get With the Program) Electrosonic Sound Jamboree uncategorized experimentalnoiseelectronicdoesnotnosoundrobotsyeszombiejamboreesupersonicelectrosonicexisthypersonicprogrambotelectronoisezombiebotcomputemaybe so 0:03:38 5 51 2012-03-10 Favorite Share Remix 21 The silence Crazy about You uncategorized the silencepoemcrazy about youlitiacoming back 0:03:39 69 422 2014-01-16 Favorite Share Remix 22 Glass Slippers (1 year Aniv.) Uprising uncategorized uprisingdubsteppianomelodicchill 0:05:00 149 3269 2012-11-26 Favorite Share Remix 23 Summer end Crazy about You uncategorized crazy about youambientchillgoodbye 0:03:16 42 1317 2015-07-01 Favorite Share Remix 24 Involved. ▽Momo▽桃. 7 Drum & Bass pink pantresspinkdnbgarage 0:02:00 42 357 2023-01-08 Favorite Share 25 Nondomo Ponyo Newbie synthbass 0:02:05 18 111 2023-10-08 Favorite Share Remix 26 Dance Floor ΞVΔN uncategorized electronicdanceparty 0:01:13 24 216 2013-05-19 Favorite Share Remix 27 The Aftalife Part 5: The One where They Deal with Climate Change (Part 1) JohnnyBonny69 Experimental aliensavant gardesensitiveok pretty badapocalypsebigwarhumanspogchampprogexcitingdecentmediocredeepmemedinosaurspoggerssadprofoundamazingcryshitpostclimate change 0:11:44 4 51 2021-05-08 Favorite Share Remix 28 Why Am I So Happy? :D (Preview?) Lamiana uncategorized crazysing-songrocklunaticyicewhykabirbishguitardrymelodicericdrumshappyfirenafisalamianadevpreview 0:00:58 8 935 2012-09-14 Favorite Share Remix 29 i wrote this for my dog (Jam!e <3 Remix) Jam!e <3 6 Indie jamiehiphopsugarlofitrapdogalternativehyperpopacousticpo9tremix 0:02:01 7 219 2024-03-01 Favorite Share Remix 30 NULL Area Retro-Synth X 5 Chiptune boss battlepermafrost 0:06:42 8 66 2024-03-07 Favorite Share 31 The Emotional Deliberations of Mr. Skull KNIFEself uncategorized electro rockvocaloidgamelyricsalternative 0:05:08 4 48 2015-02-12 Favorite Share Remix 32 PROTEIN BAR WxSTxRN ♪ Hip Hop nuthip-hopchill outchilloutstupid beat 0:01:46 4 33 2021-05-13 Favorite Share