allmonthweektoday populardaterelevant 1 Last Minut35 - Down the street Last Minut35 uncategorized edmdemooffdemonstrationdustdubstepminut35shortlastlm35nodrumscomplextronodrums 0:03:37 154 2226 2014-06-01 Favorite Share Remix 2 Christmas Canon Remix Contest (Year 2)(CallyKay) CallyKay uncategorized canonchristmasketramdancemusicboom!daymofunyay 0:02:34 44 416 2013-12-05 Favorite Share Remix 3 Undeniable CallyKay uncategorized chickenlambdabeautifulencouraginngbeen sickdaymoorchestramelodicsymphonyupliftingoriginal 0:04:13 60 550 2013-02-18 Favorite Share Remix 4 ANIMILEY Last Minut35 uncategorized rocksteprockedmmartinsamplesanimalsmileyheavygarrixcyrusvegassony 0:00:16 41 824 2014-05-15 Favorite Share Remix 5 Fun with overused samples #1 Last Minut35 uncategorized overusedglockenspielsamplespianochopdancehouseelectrogroovy 0:01:38 26 255 2013-10-22 Favorite Share Remix 6 House call ( Klub Affekt Mix) Uprising uncategorized houseuprisingi think 0:05:44 121 2236 2012-04-14 Favorite Share 7 Last Memory XculE uncategorized trancepianosad 0:03:14 27 589 2015-06-02 Favorite Share 8 the last scream from a dying immortal (pre-intro) virux (break) 1 Bass Music rockdubstepatd22soundtracktearoutviruxvoidwalkers nightmare 0:06:20 35 505 2022-12-31 Favorite Share Remix 9 different world al prog uncategorized jakethanks170bpmdnbpoordrum & bassmelodiccallyrnzr 0:03:55 33 159 2013-03-15 Favorite Share 10 Synergy (Nav X Dark) Vectorshock (DARKLITE) uncategorized 0:04:09 167 2793 2015-04-25 Favorite Share 11 apogee opaqity Ambient 2 0:03:10 319 7709 2018-01-01 Favorite Share Remix 12 i build my selfsky 1trillionMPH 1 EDM unstoppable object 0:05:11 78 915 2021-03-26 Favorite Share Remix 13 would have been (ft po9t) po9t 1 Hip Hop would have beennicohiphoptraphyperpopudmnoumenalunconditionedpo9t 0:02:51 142 4183 2022-04-06 Favorite Share 14 Sequence IV kiari Techno house 0:06:15 49 726 2014-06-03 Favorite Share Remix 15 Poet Vocal REMIX CHALLENGE (pt 2) po9t 1 Newbie challengeslowhiphoppopraprappertrappianohomepoetbeatdepressedsampleambientcompetitionvocaltypesadsingingremix 0:02:33 214 5590 2021-03-18 Favorite Share Remix 16 moonboy, for sebastian looks 7 uncategorized 0:01:58 266 5055 2016-02-21 Favorite Share Remix 17 Blueshift [2K] synthonix 2 Drum & Bass garlic bread 0:02:15 115 1678 2020-07-22 Favorite Share 18 Remix Contest! Panic Attack (Goodbye) uncategorized 0:01:07 29 1354 2012-09-09 Favorite Share Remix 19 PO9T VOCAL REMIX CHALLENGE (4) po9t 1 Newbie challengehiphoppopacapellatrappunkfuckgregsamplecompetitionvocalpoorstacypo9tsingingremix 0:00:53 138 2739 2021-11-20 Favorite Share Remix 20 Wind Audial Ambient soundtrackpadwindairy 0:04:48 87 1233 2014-02-24 Favorite Share 21 2faced (ft heads) po9t 7 Hip Hop experimentalxxxtentacionemoindiepeepdepressingguardinhiphoppoprapbedroompowfugothlofilyricstraplilpunk2facedpoetvocalsboysadmixinguwu 0:02:07 81 1306 2020-11-01 Favorite Share 22 Ryann's Theme po9t 1 Rock ryannsindietrancepophiphopshoegazetrapindie popsynthpopthemepo9t 0:02:43 154 5973 2023-04-04 Favorite Share 23 Dawn of the Revolution Rick Astley uncategorized richardjamesastley 0:05:36 32 325 2014-05-06 Favorite Share Remix 24 a letter to my mistress feat. joe Kibbeyjoe 1 Hip Hop joekibbey 0:02:48 139 5203 2021-09-06 Favorite Share Remix 25 bring the machines down ABADDON uncategorized abaddonthe doctorget your life back 0:06:24 44 395 2012-03-04 Favorite Share Remix 26 Unbreakable (xavrockbeats Remix) Xavi uncategorized t-t-todayjunior 0:04:12 43 1289 2012-11-09 Favorite Share Remix 27 You dont like dubstep? ZOD4X uncategorized zod4xdubstephater 0:04:06 41 1517 2012-12-04 Favorite Share Remix 28 NATSUKASHII Tim Derry 1 House labi siffresunnyafricagilligan mossacousticfree9/9 0:04:36 38 588 2023-09-25 Favorite Share Remix 29 Feathers (Gravidon Remix) [A.K.A. Dimensions] Gravidon Drum & Bass formatbacon xdmarathondifferentfeathersdnbchangeperspectivegravidondark-prince3rdfundimensionsxenondrum & basscompetitonformsagadivinelightemotionalremix 0:06:40 57 710 2013-04-02 Favorite Share Remix 30 City Lights fauko uncategorized synthcitypulvlights 0:03:00 31 614 2012-02-26 Favorite Share Remix 31 Whispers of Death EscapingRealityZir0hWOLFEYE 2 Bass Music dubstepscreamssampleshalloweenold track 0:02:54 55 656 2022-10-30 Favorite Share Remix 32 You Can Make It (SS Remix Comp) Citryx uncategorized do youcompetionremixstay strong:3 0:04:51 39 895 2015-05-26 Favorite Share Remix