allmonthweektoday populardaterelevant 1 "World Domination" Avoyd X DJskylegend DJskylegendAvoyd uncategorized metro boomintuffmetrogsngtraplit 0:02:39 11 334 2018-09-30 Favorite Share 2 The Fusion (VS Dominick Soth) Djprevost uncategorized electrohouse 0:04:28 5 95 2012-05-26 Favorite Share 3 BIG MAC DJ Khaled West 1 Hip Hop 0:03:41 742 29408 2019-01-24 Favorite Share Remix 4 Prod. Domo djohnson12345 uncategorized i make beats 0:04:16 2 13 2014-03-07 Favorite Share Remix 5 LUXXISDEAD & DJKW - 2D GIRLS! (REMIX) kasel (on fl now)luxxisdead Hip Hop rapkasel2d girls remixluxx and kasel the samedj khaled westluxxisdead 0:03:01 17 245 2020-04-22 Favorite Share 6 Prod. Domo djohnson12345 uncategorized we dumb domo 0:03:00 1 23 2014-03-05 Favorite Share 7 Prod. Domo djohnson12345 uncategorized i got beats 0:03:18 1 21 2014-03-06 Favorite Share Remix 8 Hardstyle Domination DJ-PAIN uncategorized painkick150bpmhardkickdj-painrawkickeffectrawhardstyle 0:03:39 3 74 2014-05-05 Favorite Share 9 Dembow Dominicana Dj Gallo Reggae reggaetondominicanrepublicdembowrepulica dominicanael alfa 0:02:28 4 71 2022-06-24 Favorite Share 10 Domination RACE full song DJ-HOOVS uncategorized dubstep&rap 0:02:47 3 17 2013-08-04 Favorite Share Remix 11 Fre-AKY-dom dj_kellen uncategorized hello 0:00:50 2 24 2013-12-27 Favorite Share 12 Domination RACE Preview DJ-HOOVS uncategorized dubstep&rap 0:01:41 2 25 2013-08-03 Favorite Share Remix 13 Vibe Domain Lello_Oliver uncategorized dj woodmoz 0:03:52 7 31 2017-08-20 Favorite Share Remix 14 Domiena (WIP) [DJ Thijs Remix] Thivale uncategorized 0:02:19 6 21 2015-01-18 Favorite Share Remix 15 VANILLA DOME Djnosh uncategorized mariovideogamesvideogameworldsupergames 0:05:41 1 33 2013-03-28 Favorite Share Remix 16 Christian Chrom - Hardstyle Domination (D-Strukzion Remix) D-Strukzion uncategorized hardstyledominationchristian-chromremix 0:02:52 10 308 2017-09-30 Favorite Share Remix 17 Domingo´s Club DJGTC uncategorized domingoclubdjgtc 0:03:10 1 1457 2012-09-09 Favorite Share Remix 18 RSX djer uncategorized 0:02:36 1 72 2011-08-12 Favorite Share Remix 19 DjGavmans dup domination GEEREXED uncategorized electronicdupstep drumsand fading 0:01:32 1 27 2012-06-22 Favorite Share Remix 20 Oxia-Domino, Mezclamus Remix DJ 8 Dimension Newbie dominooxiaremixescalofrios 0:04:32 2 10 2023-02-25 Favorite Share Remix 21 DJ Fresh VS Diplo Feat Dominique Young Unique - Earthquake (Official MaazIzBaaz Bruh remix) Maas uncategorized bruh 0:00:33 4 274 2015-09-06 Favorite Share Remix 22 GOOD JOB LARRY JUNE X DOM KENNEDY T.Y.B PLUGG uncategorized #peep #lilpeep 0:01:59 4 39 2018-08-11 Favorite Share Remix 23 DJ PAULO CAVALIERI - DOMINATION (PRÉVIA) Dj Paulo Cavalieri uncategorized hardstyle eletronica dance music 0:03:22 1 26 2014-03-08 Favorite Share Remix 24 Dj Hitek - Domination Hitek20 uncategorized 0:03:48 1 80 2013-07-02 Favorite Share Remix 25 ORGANIC DOM KENNEDY T.Y.B PLUGG uncategorized 0:03:46 1 21 2018-08-13 Favorite Share Remix 26 AUTO PILOT DOM KENNEDY T.Y.B PLUGG uncategorized 0:02:37 1 33 2018-08-25 Favorite Share Remix 27 | Don't Miss Me | DJ PUrG3© Trap domt miss me2020old schoolsmoothchill traprapchill outbalanced808type beatinstrumentaljokehip hoprnbgame 0:03:06 1 11 2020-06-02 Favorite Share 28 gemini remix Nosleep gng Hip Hop 0:02:40 1 28 2020-07-28 Favorite Share Remix 29 BIG MAC treefreedom007_gmail_com Hip Hop 0:03:41 1 40 2021-07-19 Favorite Share Remix 30 BIG MAC Scoops the poop Turdboy620 Hip Hop filthydelightful 0:03:41 1 14 2021-09-19 Favorite Share Remix 31 BIG MAC 2 because its sounds interesting ZBoyN Hip Hop 0:03:41 1 5 11 days ago Favorite Share Remix 32 World Domination InDeafinite uncategorized 0:03:01 0 31 2011-07-04 Favorite Share Remix
