allmonthweektoday populardaterelevant 1 "World Domination" Avoyd X DJskylegend DJskylegendAvoyd uncategorized metro boomintuffmetrogsngtraplit 0:02:39 11 334 2018-09-30 Favorite Share 2 BIG MAC DJ Khaled West 1 Hip Hop 0:03:41 725 28361 2019-01-24 Favorite Share Remix 3 LUXXISDEAD & DJKW - 2D GIRLS! (REMIX) kasel (on fl now)luxxisdead Hip Hop rapkasel2d girls remixluxx and kasel the samedj khaled westluxxisdead 0:03:01 17 240 2020-04-22 Favorite Share 4 Hardstyle Domination DJ-PAIN uncategorized painkick150bpmhardkickdj-painrawkickeffectrawhardstyle 0:03:39 3 72 2014-05-05 Favorite Share 5 Vibe Domain Lello_Oliver uncategorized dj woodmoz 0:03:52 7 31 2017-08-20 Favorite Share Remix 6 Domiena (WIP) [DJ Thijs Remix] Thivale uncategorized 0:02:19 6 21 2015-01-18 Favorite Share Remix 7 Dembow Dominicana Dj Gallo Reggae reggaetondominicanrepublicdembowrepulica dominicanael alfa 0:02:28 3 47 2022-06-24 Favorite Share 8 Christian Chrom - Hardstyle Domination (D-Strukzion Remix) D-Strukzion uncategorized hardstyledominationchristian-chromremix 0:02:52 9 299 2017-09-30 Favorite Share Remix 9 Oxia-Domino, Mezclamus Remix DJ 8 Dimension Newbie dominooxiaremixescalofrios 0:04:32 2 10 2023-02-25 Favorite Share Remix 10 DJ Fresh VS Diplo Feat Dominique Young Unique - Earthquake (Official MaazIzBaaz Bruh remix) Maas uncategorized bruh 0:00:33 4 274 2015-09-06 Favorite Share Remix 11 GOOD JOB LARRY JUNE X DOM KENNEDY T.Y.B PLUGG uncategorized #peep #lilpeep 0:01:59 3 37 2018-08-11 Favorite Share Remix 12 AUTO PILOT DOM KENNEDY T.Y.B PLUGG uncategorized 0:02:37 1 33 2018-08-25 Favorite Share Remix 13 ORGANIC DOM KENNEDY T.Y.B PLUGG uncategorized 0:03:46 1 21 2018-08-13 Favorite Share Remix 14 | Don't Miss Me | DJ PUrG3© Trap domt miss me2020old schoolsmoothchill traprapchill outbalanced808type beatinstrumentaljokehip hoprnbgame 0:03:06 1 11 2020-06-02 Favorite Share 15 BIG MAC Scoops the poop Turdboy620 Hip Hop filthydelightful 0:03:41 1 14 2021-09-19 Favorite Share Remix 16 BIG MAC treefreedom007_gmail_com Hip Hop 0:03:41 1 40 2021-07-19 Favorite Share Remix 17 gemini remix Nosleep gng Hip Hop 0:03:07 1 26 2020-08-03 Favorite Share Remix 18 gemini remix Nosleep gng Hip Hop 0:02:40 1 28 2020-07-28 Favorite Share Remix 19 BIG MAC ChezManTVonyoutube Hip Hop 0:03:41 0 10 2024-01-31 Favorite Share Remix 20 Oxia-Domino, Dj 8 Dimension, trap remix DJ 8 Dimension Newbie dominooxiaremixescalofrios 0:04:32 0 1 2023-10-22 Favorite Share Remix 21 DOME DJ PURPLE Newbie 0:00:13 0 3 2023-01-13 Favorite Share Remix 22 BIG MAC ザビートキング Hip Hop 0:03:41 0 31 2021-12-05 Favorite Share Remix 23 "Copyright Criminals" dj1234354 Other 0:01:15 0 6 2020-12-20 Favorite Share Remix 24 BIG MAC AudioFileNotFound Hip Hop 0:03:41 0 97 2020-02-03 Favorite Share 25 BIG BIG BIG BIG MAC MAC MAC bubbley Hip Hop 0:03:41 0 41 2020-01-04 Favorite Share Remix 26 hardstyle domination9(remix) DJNL uncategorized hardstyle 0:03:20 0 23 2016-12-11 Favorite Share Remix 27 DJ BrU - Trap Dominator DJ BRU And Psykotika uncategorized 0:03:42 0 102 2016-08-25 Favorite Share 28 Domination DJ Bazz Phaze uncategorized 0:04:24 0 12 2015-02-27 Favorite Share Remix 29 DJK - NewGen domin1234 uncategorized 0:03:51 0 5 2014-12-27 Favorite Share 30 DJK - NewGen domin1234 uncategorized 0:02:23 0 2 2014-12-27 Favorite Share 31 crazy in dominican republic 2014 p9DsEGBf uncategorized hardwelldjovalles 0:01:21 0 77 2014-07-30 Favorite Share Remix 32 The Dominator Dj Ebin uncategorized 0:02:51 0 8 2014-06-10 Favorite Share Remix